PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC050611.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family GATA
Protein Properties Length: 275aa    MW: 29270.6 Da    PI: 8.2014
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC050611.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA54.41.7e-17179212134
          GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                   C +C  tkTp+WR gp g+ktLCnaCG++y++ +
  EcC050611.10 179 CLHCEITKTPQWRAGPLGPKTLCNACGVRYKSGR 212
                   99*****************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011411.49173209IPR000679Zinc finger, GATA-type
SMARTSM004014.3E-15173223IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.9E-14177211IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577167.6E-15177236No hitNo description
CDDcd002022.58E-13178227No hitNo description
PROSITE patternPS003440179204IPR000679Zinc finger, GATA-type
PfamPF003203.9E-15179212IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005975Biological Processcarbohydrate metabolic process
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0016868Molecular Functionintramolecular transferase activity, phosphotransferases
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
YEDIVQLEWL STFVEESFSG GSLTMSKEQV SNGGGGGGGG SGGGNNTDSS SQQFQTSSPV  60
SVLESSSSCS VDNKPRPPSP EAINPARCGR ARSKRPRPAN FNPRPAIQLA PQQSSDVAEN  120
EPGSENSEES NCLPVIKAPK KQASGGAEPK KKKKIKFTMP PAPPAEADQG LPQQAVRKCL  180
HCEITKTPQW RAGPLGPKTL CNACGVRYKS GRLYPEYRPA ASPTFIPSLH SNSHKKVLEM  240
RNKTTDNADD SGTASAVTDS LELIPNMSGW ITCED
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19397KRPRP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010032187.11e-161PREDICTED: GATA transcription factor 8-like isoform X2
TrEMBLA0A059ACM41e-159A0A059ACM4_EUCGR; Uncharacterized protein
STRINGGLYMA02G08145.12e-88(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54810.21e-41GATA family protein